PYTHON Zadanie 1 W Biopython, posługując się wybranym

advertisement
PYTHON Zadanie 1 W Biopython, posługując się wybranym alfabetem (IUPAC, alfabet uwzględniający tylko podstawowe zasady) zapisz następujący fragment sekwencji DNA "CCGGGTT" a następnie: a) podaj zasady komplementarne do w/w sekwencji oraz zasady komplementarne w odwróconej sekwencji b) podaj sekwencję RNA utworzoną na bazie w/w sekwencji DNA, a następnie korzystając z określonej metody wrócić z RNA do DNA; c) oblicz procent zasad G i C w w/w sekwencji DNA Zadanie 2 Utwórz skrypt, który będzie: a) z podanej przez użytkownika sekwencji zapisanej w alfabecie Bio.Alphabet.IUPAC.unambiguous_dna wycinał fragment o podanych przez użytkownika współrzędnych (indeks początkowy i końcowy). b) umożliwiał połączenie dwóch dowolnych sekwencji nukleotydowych podanych przez użytkownika (skorzystaj z alfabetu generic nucleotide). !
Zadanie 3 Dla fragmentu sekwencji DNA: "ATTATCCTACACGATACCTACTACGTTTATTCACAATAGGAGGATTA” utwórz obiekt MutableSeq, a następnie w w/w sekwencji: podmień zasady na 6 i 10 miejscu na „A”, usuń pierwszą napotkaną zasadę T, odwróć tak zmodybikowaną sekwencję, a na koniec przekształć ją z powrotem na obiekt Seq !
Zadanie 4. Dla sekwencji (protein):"MKSILDGLADTTFRTITTDLLGSPFQEKMTAGDNP" korzystając z Bio.Blast określ 5 pierwszych dopasowań, wyświetl tytuł dopasowanej sekwencji i długość dopasowania. Wyznacz średnią długość dopasowania. !
!
R !
Zadanie 1. Napisz funkcję, która wczytuje plik w formacie FASTA zawierający więcej niż jedną sekwencję DNA i generuje dla każdej z nich 6 możliwych ramek odczytu. Wskazówka. Użyj biblioteki Biostrings. Użyj funkcji readDNAStringSet do wczytania sekwencji, funkcji DNAStringSet do przycięcia sekwencji oraz funkcji reverseComplement do wygenerowania 6 ramek odczytu. !
Zadanie 2. Napisz funkcję, która wczytuje plik w formacie FASTA zawierający więcej niż jedną sekwencję aminokwasową, następnie wykonuje przyrównanie lokalne każdego z każdym używając zadanych parametrów {macierz podobieństwa, kara za otwarcie i kara za kontynuację przerwy w przyrównaniu. Wskazówka. Użyj biblioteki Biostrings. Użyj funkcji readAAStringSet do wczytania sekwencji, funkcji pairwiseAlignment do generowania przyrówań. !
Zadanie 3. Napisz w R funkcję, która wybiera ze zbioru N wektorów jego reprezentatywny podzbiór o poziomie podobieństwa (mierzonym kwadratem korelacji) mniejszym niż zadany parametr X z przedziału (0,1). Żaden z wektorów reprezentatywnego podzbioru nie może mieć podobieństwa (mierzonego kwadratem korelacji) większego niż X dla każdego elementu w podzbiorze. Dla każdego elementu odrzuconego musi istnieć w zbiorze reprezentatywnym jego reprezentant o podobieństwie większym niż X. !
!
Download
Random flashcards
bvbzbx

2 Cards oauth2_google_e1804830-50f6-410f-8885-745c7a100970

Prace Magisterskie

2 Cards Pisanie PRAC

Create flashcards